PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00003.226
Common NameAMTR_s00003p00229970, LOC18431441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 312aa    MW: 34047.7 Da    PI: 7.1301
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00003.226genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.3e-33137194259
                                               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                               +Dgy+WrKYGqK vk+s++prsYYrCts++C vkk+vers edp++v++tYeg+H+h+
  evm_27.model.AmTr_v1.0_scaffold00003.226 137 EDGYRWRKYGQKAVKNSPYPRSYYRCTSPKCGVKKRVERSFEDPSTVITTYEGQHTHQ 194
                                               8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-35121196IPR003657WRKY domain
SuperFamilySSF1182901.83E-29128196IPR003657WRKY domain
PROSITE profilePS5081131.261131196IPR003657WRKY domain
SMARTSM007741.7E-39136195IPR003657WRKY domain
PfamPF031063.3E-26137194IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEEEEANPLA GNRRNPASVL SESAFGGDFE SSTFTELLGI HDFSSPFMDF APPLLPEFPI  60
PSLNSGDPPE NSNLPATPNS SISSSSTEAN EDDGASRNIK DEQEKVKKVS KPKKKTQKRQ  120
REPRVAFMTK SEVDHLEDGY RWRKYGQKAV KNSPYPRSYY RCTSPKCGVK KRVERSFEDP  180
STVITTYEGQ HTHQSPASLR GGGGAPSSSG SSSSSSMSMA ATLESGFGAF PMQMMVQRAS  240
QDPNNTSASH SSIYMNQAFS SLPFPSPFPN ILSRFCNPTI SGTTTTQNIQ AQLRDHGLLQ  300
DIVPSDMRKD T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-281291971078Probable WRKY transcription factor 4
1wj2_A2e-281291971078Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006841629.10.0PREDICTED: probable WRKY transcription factor 48
SwissprotO229002e-53WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLW1P6L20.0W1P6L2_AMBTC; Uncharacterized protein
STRINGPOPTR_0002s19390.12e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-41WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]